HORDB

ID: hor002032
Uniprot ID: Q95335
Protein name: Gonadoliberin-1
Gene name: GNRH1
Organism: Tupaia belangeri (Common tree shrew) (Tupaia glis belangeri)
Family: GnRH family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Tupaia (genus), Tupaiidae (family), Scandentia (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: QHWSYGLRPG
Length: 10
Propeptide: MELVPKFLAGLILLTLCVGGCYAQHWSYGLRPGGKRNAENLIDSFQEIAKEADQLAEPQHFECTISQPRSPLRALKGALESLIEEETGQKKI
Signal peptide: MELVPKFLAGLILLTLCVGGCYA
Modification: T1 Pyrrolidone carboxylic acid;T10 Glycine amide
Glycosylation: NA
Mutagenesis: NA

Function: Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002032_AF2.pdb

hor002032_ESM.pdb

Mass:	136103	Formula:	C55H77N17O14
Absent amino acids:	ACDEFIKMNTV	Common amino acids:	G
pI:	9.35	Basic residues:	2
Polar residues:	4	Hydrophobic residues:	2
Hydrophobicity:	-128	Boman Index:	-1953
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	39
Instability Index:	3615	Extinction Coefficient cystines:	6990
Absorbance 280nm:	776.67